10 products were found matching "GeneID 29994"!

Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium]

Human Bromodomain adjacent to zinc finger domain, 2B or BAZ2B, amino-acids 2054 ? 2168 (end), GenBank Accession No. NM_013450 with N-terminal HIS-tag, MW = 14.3 kDa, expressed in an E. coli expression system.

The BAZ2B Inhibitor Screening Assay Kit is designed to measure the inhibition of BAZ2B bromodomain binding to its substrate. The kit comes in a convenient AlphaLISA(R) format, with biotinylated histone peptide substrate, assay buffer, detection buffer and purified BAZ2B for 384 assays.

0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Bromodomain adjacent to zinc finger domain, 2B Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium]

BAZ2B Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. BAZ2B Antibody is a high quality polyclonal antibody for research use only.. Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt...

Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 75% and to rat: 75%

Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 91% and to rat: 89%

BAZ2B (Bromodomain Adjacent To Zinc Finger Domain, 2B) is a Protein Coding gene. Source: Recombinant protein corresponding to aa2054-2168 from human BAZ2B, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.3kD, AA Sequence: MHHHHHHSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKP,...

Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.

Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.